Retinoic Acid Receptor alpha anticorps (N-Term)

N° du produit ABIN629874

Cet anticorps anti-Retinoic Acid Receptor alpha est un anticorps Lapin Polyclonal détectant Retinoic Acid Receptor alpha dans WB. Adapté pour Humain.

Aperçu rapide pour Retinoic Acid Receptor alpha anticorps (N-Term) (ABIN629874)

Antigène: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Retinoic Acid Receptor alpha est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Retinoic Acid Receptor alpha anticorps

Épitope: N-Term

Specificité: RARA antibody was raised against the N terminal of RARA

Purification: Purified

Immunogène: RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids TPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RARA Blocking Peptide, (ABIN5615760), is also available for use as a blocking control in assays to test for specificity of this RARA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Retinoic Acid Receptor alpha

Antigène: Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))

Autre désignation: RARA

Sujet: RARA contains 1 nuclear receptor DNA-binding domain and belongs to the nuclear hormone receptor family, NR1 subfamily. It is a receptor for retinoic acid. This metabolite has profound effects on vertebrate development. Retinoic acid is a morphogen and is a powerful teratogen. This receptor controls cell function by directly regulating gene expression

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteins